PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.03G047300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family TALE
Protein Properties Length: 573aa    MW: 63516.3 Da    PI: 6.1599
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.03G047300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.21.3e-084965341854
                          HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          +F++  ++yp+ +e+  LA + gLt++qV++WF N R +
  Manes.03G047300.1.p 496 MFQNflHPYPKDAEKHLLAVRSGLTKSQVSNWFINARVR 534
                          5887779******************************88 PP

2BELL77.71.7e-25368437272
                 BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                          +++l +kk +Ll+ll+ Vd+rY+q+ ++++tv+s+F+a+++l++ +++t++Al++iS+ +++L+ +i++qi
  Manes.03G047300.1.p 368 KRALDSKKIQLLTLLQVVDDRYNQCLDEIHTVVSAFHAATELDP-QIHTRFALHTISFLYKSLRWRISNQI 437
                          67899***************************************.************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.1E-21287435IPR006563POX domain
PfamPF075262.5E-23292434IPR006563POX domain
PROSITE profilePS5007111.062475538IPR001356Homeobox domain
CDDcd000866.12E-11478539No hitNo description
SMARTSM003898.7E-6478542IPR001356Homeobox domain
SuperFamilySSF466893.42E-15480547IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-25481544IPR009057Homeodomain-like
PfamPF059209.9E-15495534IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 573 aa     Download sequence    Send to blast
MENRLFSVPV DVVGRNSIAM EGIGSQITPN SLVQFDSFDL NNQNQTLDGY TLPGAPINDL  60
HTDNRAAIVD SEVFVTSLEK NVARGEEFQE QFLGGIPISG PALATLAASR SGHQENLTNL  120
AISEPLMYPL EALKTYASNG FFNGLNSSFA SSVNNGFCEV FGNTNAKEDI NRFPASVEHS  180
GKTPTRTGFQ SYSSIGNLEP NSWISANSVI VSSDNPYGSC HFSNELSLSL ATSQPSAING  240
SRVTDQCSEI SCSDVTRHCL EETRLCLEQT SSSSKELCLS CGSYENGQFS QVIAGSIYVQ  300
VIQEILAQIA SYSLENLGQI STSGIMIGPN IPSFSSYPIE GRMRLMGSDE SPNVDNIFGV  360
QVDPALQKRA LDSKKIQLLT LLQVVDDRYN QCLDEIHTVV SAFHAATELD PQIHTRFALH  420
TISFLYKSLR WRISNQILAM GAYFDGGGAK EAEGSLETSC FQKQWTLQQL KKKDHQLWRP  480
QRGLPERSVS VLRAWMFQNF LHPYPKDAEK HLLAVRSGLT KSQVSNWFIN ARVRLWKPMI  540
EEMYAEMNRR KVSQKEEGAN RNHRNHISNL RF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A7e-15484541158Homeobox protein Meis1
4xrs_B7e-15484541158Homeobox protein Meis1
5bng_A7e-15484542159Homeobox protein Meis2
5bng_B7e-15484542159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015573161.10.0PREDICTED: homeobox protein ATH1
RefseqXP_015573162.10.0PREDICTED: homeobox protein ATH1
RefseqXP_015573163.10.0PREDICTED: homeobox protein ATH1
SwissprotP487311e-113ATH1_ARATH; Homeobox protein ATH1
TrEMBLA0A067KP980.0A0A067KP98_JATCU; Uncharacterized protein
STRINGPOPTR_0018s05080.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59393249
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.11e-108homeobox gene 1